PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400017131
Common NameLOC102593379
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 319aa    MW: 36166.1 Da    PI: 7.0027
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400017131genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.21.7e-33173230259
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           +Dgy+WrKYGqK vk+s++prsYYrCts++C+vkk+vers +dp++v++tYeg+Hnh+
  PGSC0003DMP400017131 173 EDGYRWRKYGQKAVKNSPYPRSYYRCTSQKCQVKKRVERSYQDPSIVITTYEGQHNHH 230
                           8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.1E-35158232IPR003657WRKY domain
SuperFamilySSF1182901.28E-29164232IPR003657WRKY domain
PROSITE profilePS5081132.42167232IPR003657WRKY domain
SMARTSM007745.9E-39172231IPR003657WRKY domain
PfamPF031065.0E-26173230IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGDELRDLYY HQPFQEDIRH DSSMVQNIHM LDPSFMSYTS EYLHGSSSDY ITNNSLGKPF  60
GFSTPSPLSS LKDDDIIKQD HVDANVNYIN NNDVVGGGGG SETPVTPNSS ISNSSSNGDH  120
EDSNKKDKQV KDETLEDGED ASKKESKAKK KGEKKQRPPK FAFMTKSEVD HLEDGYRWRK  180
YGQKAVKNSP YPRSYYRCTS QKCQVKKRVE RSYQDPSIVI TTYEGQHNHH LPATLRGSVA  240
RMLNPSMLAQ PSPLMAPQAS FHQEFIMSQM PQFYGHANAF ANSSMYHHQQ QMQLPHPHHD  300
YGLLQDMVPS MFNLKQEP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-281652331078Probable WRKY transcription factor 4
2lex_A8e-281652331078Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00440DAPTransfer from AT4G18170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-180HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006355604.10.0PREDICTED: probable WRKY transcription factor 71
TrEMBLM1AL070.0M1AL07_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000251130.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14852475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.14e-55WRKY DNA-binding protein 71
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]